HPA030225

PSMB10 antibody from MilliporeSigma / Merck KGaA
beta2i, LMP10, MECL1, MGC1665
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030225
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030225, RRID:AB_10603231
Product name
Anti-PSMB10 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030225
Antibody type
Polyclonal
Antigen
proteasome (prosome, macropain) subunit, beta type, 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEP
VKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQA
MEVE
Storage
-20C
Provider Type Product Number
- No reagents -