HPA030092

KCTD20 antibody from MilliporeSigma / Merck KGaA
C6orf69, dJ108K11.3, MGC14254
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030092
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030092, RRID:AB_10601437
Product name
Anti-KCTD20 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030092
Antibody type
Polyclonal
Antigen
potassium channel tetramerisation domain containing 20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFG
SNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPDTML
Storage
-20C
Provider Type Product Number
- No reagents -