Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [4]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000573-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000573-M02, RRID:AB_463972
- Product name
- BAG1 monoclonal antibody (M02), clone 2D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BAG1.
- Antigen sequence
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLD
RRVKATIEQFMKILEEIDTLILPENFKDSRLKRKG
LVKKVQAFLAECDTVEQNICQETERLQSTNFALAE- Isotype
- IgG
- Antibody clone number
- 2D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BAG1 monoclonal antibody (M02), clone 2D3 Western Blot analysis of BAG1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BAG1 monoclonal antibody (M02), clone 2D3. Western Blot analysis of BAG1 expression in LNCaP ( Cat # L004V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BAG1 monoclonal antibody (M02), clone 2D3. Western Blot analysis of BAG1 expression in NIH/3T3(Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BAG1 monoclonal antibody (M02), clone 2D3. Western Blot analysis of BAG1 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged BAG1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to BAG1 on HeLa cell. [antibody concentration 35 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to BAG1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol