Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011329-M11 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011329-M11, RRID:AB_566001
- Product name
- STK38 monoclonal antibody (M11), clone 2F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STK38.
- Antigen sequence
EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISI
EIKSIDDTSNFDEFPESDILKPTVATSNHPETDYK
NKDWVFINYTYKRFEGLTARGAIPSYMKAAK- Isotype
- IgG
- Antibody clone number
- 2F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Serine-Threonine Kinase 38 regulates CDC25A stability and the DNA damage-induced G2/M checkpoint.
Constitutively active NDR1-PIF kinase functions independent of MST1 and hMOB1 signalling.
Fukasawa T, Enomoto A, Miyagawa K
Cellular signalling 2015 Aug;27(8):1569-75
Cellular signalling 2015 Aug;27(8):1569-75
Constitutively active NDR1-PIF kinase functions independent of MST1 and hMOB1 signalling.
Cook D, Hoa LY, Gomez V, Gomez M, Hergovich A
Cellular signalling 2014 Aug;26(8):1657-67
Cellular signalling 2014 Aug;26(8):1657-67
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STK38 monoclonal antibody (M11), clone 2F6. Western Blot analysis of STK38 expression in human kidney.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STK38 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to STK38 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human colon. [antibody concentration 2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol