H00152503-M01
antibody from Abnova Corporation
Targeting: SH3D19
DKFZp434D0215, EBP, Eve-1, EVE1, Kryn, SH3P19
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00152503-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00152503-M01, RRID:AB_566183
- Product name
- SH3D19 monoclonal antibody (M01), clone 5C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SH3D19.
- Antigen sequence
PVTKPELPKKPNPGLIRSVNPEIPGRGPLAESSDS
GKKVPTPAPRPLLLKKSVSSENPTYPSAPLKPVTV
PPRLAGASQAKAYKSLGEGPPANPPVPVLQSKPLV
DIDLI- Isotype
- IgG
- Antibody clone number
- 5C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SH3D19 monoclonal antibody (M01), clone 5C7. Western Blot analysis of SH3D19 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SH3D19 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SH3D19 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol