HPA016424

SH3D19 antibody from Sigma-Aldrich
DKFZp434D0215, EBP, EVE1, Kryn, SH3P19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016424
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016424, RRID:AB_1856814
Product name
Anti-SH3D19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016424
Antibody type
Polyclonal
Antigen
SH3 domain-containing protein 19 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IFPANYVKVIIDIPEGGNGKRECVSSHCVKGSRCV
ARFEYIGEQKDELSFSEGEIIILKEYVNEEWARGE
VRGRTGIFPLNFVEPVEDYPTSGANVLSTKVPLKT
KKEDSGSNSQVNSLPAEWCEAL
Storage
-20C
Provider Type Product Number
- No reagents -