HPA016424

SH3D19 antibody from Atlas Antibodies
DKFZp434D0215, EBP, Eve-1, EVE1, Kryn, SH3P19
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016424
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016424, RRID:AB_1856814
Product name
Anti-SH3D19
Provider product page
Atlas Antibodies - HPA016424
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IFPANYVKVIIDIPEGGNGKRECVSSHCVKGSRCV
ARFEYIGEQKDELSFSEGEIIILKEYVNEEWARGE
VRGRTGIFPLNFVEPVEDYPTSGANVLSTKVPLKT
KKEDSGSNSQVNSLPAEWCEAL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -