Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006428-M08 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006428-M08, RRID:AB_566179
- Product name
- SFRS3 monoclonal antibody (M08), clone 2D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SFRS3.
- Antigen sequence
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGP
LRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRT
LCGCRVRVELSNGEK- Isotype
- IgG
- Antibody clone number
- 2D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references An shRNA-based screen of splicing regulators identifies SFRS3 as a negative regulator of IL-1β secretion.
LBH589 induces up to 10-fold SMN protein levels by several independent mechanisms and is effective even in cells from SMA patients non-responsive to valproate.
Moura-Alves P, Neves-Costa A, Raquel H, Pacheco TR, D'Almeida B, Rodrigues R, Cadima-Couto I, Chora Â, Oliveira M, Gama-Carvalho M, Hacohen N, Moita LF
PloS one 2011;6(5):e19829
PloS one 2011;6(5):e19829
LBH589 induces up to 10-fold SMN protein levels by several independent mechanisms and is effective even in cells from SMA patients non-responsive to valproate.
Garbes L, Riessland M, Hölker I, Heller R, Hauke J, Tränkle C, Coras R, Blümcke I, Hahnen E, Wirth B
Human molecular genetics 2009 Oct 1;18(19):3645-58
Human molecular genetics 2009 Oct 1;18(19):3645-58
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SFRS3 monoclonal antibody (M08), clone 2D2 Western Blot analysis of SFRS3 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SFRS3 monoclonal antibody (M08), clone 2D2. Western Blot analysis of SFRS3 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SFRS3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SFRS3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol