Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006428-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006428-M06, RRID:AB_10718925
- Product name
- SFRS3 monoclonal antibody (M06), clone 1C8
- Antibody type
- Monoclonal
- Antigen
- SFRS3 (NP_003008, 1 a.a. ~ 85 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGP
LRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRT
LCGCRVRVELSNGEK- Isotype
- IgG
- Vial size
- 50 μg
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SFRS3 monoclonal antibody (M06), clone 1C8. Western Blot analysis of SFRS3 expression in K-562(Cat # L009V1 ).
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SFRS3 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SFRS3 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol