Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004681-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004681-M01, RRID:AB_606638
- Product name
- NBL1 monoclonal antibody (M01), clone 2G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NBL1.
- Antigen sequence
INKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQN
RACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSM
WEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKE
PSHEG- Isotype
- IgG
- Antibody clone number
- 2G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NBL1 monoclonal antibody (M01), clone 2G4 Western Blot analysis of NBL1 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NBL1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol