HPA007394

NBL1 antibody from Sigma-Aldrich
D1S1733E, DAN, DAND1, NB, NO3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007394
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007394, RRID:AB_10601272
Product name
Anti-NBL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007394
Antibody type
Polyclonal
Antigen
neuroblastoma, suppression of tumorigenicity 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSI
QNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQ
SMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACG
KEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPG
GQTPEPE
Storage
-20C
Provider Type Product Number
- No reagents -