Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309911 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Polymerase (RNA) II (DNA Directed) Polypeptide I, 14.5kDa (POLR2I) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-POLR2I antibody: synthetic peptide directed towards the N terminal of human POLR2I
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILL
YACRN CDYQQEADNS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The DNA sequence and biology of human chromosome 19.
Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM
Nature 2004 Apr 1;428(6982):529-35
Nature 2004 Apr 1;428(6982):529-35
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting