Antibody data

Product number
H00057045-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057045-M07, RRID:AB_1205138
Product name
TWSG1 monoclonal antibody (M07), clone 2F3
Provider product page
Abnova Corporation - H00057045-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TWSG1.
Antigen sequence
MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDV
SKCLIQELCQCRPGEGNCSCCKECMLCLGALWDEC
CDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFR
ALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETV
NQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDC
MSIHQCKISCESMGASKYRWFHNACCECIGPECID
YGSKTVKCMNCMF
Isotype
IgG
Antibody clone number
2F3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -