HPA014898

TWSG1 antibody from MilliporeSigma / Merck KGaA
TSG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014898
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014898, RRID:AB_1858467
Product name
Anti-TWSG1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014898
Antibody type
Polyclonal
Antigen
Twisted gastrulation protein homolog 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPS
LFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFL
ETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYF
DDCMSIHQCKISCESMGASKYRWFHNACCECIGPE
CIDYGSKTVK
Storage
-20C
Provider Type Product Number
- No reagents -