H00084858-B01P

ZNF503 antibody from Abnova Corporation
FLJ45745, MGC2555, Nlz2

Antibody data

Product number
H00084858-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084858-B01P, RRID:AB_1582118
Product name
ZNF503 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00084858-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZNF503 protein.
Antigen sequence
MSTAPSLSALRSSKHSGGGGGGGGGGGADPAWTSA
LSGNSSGPGPGSSPAGSTKPFVHAVPPSDPLRQAN
RLPIKVLKMLTARTGHILHPEYLQPLPSTPVSPIE
LDAKKSPLALLAQTCSQIGKPDPSPSSKLSSVASN
GGGAGGAGGGAAGDKDTKSGPLKLSDIGVEDKSSF
KPYSKPGSDKKEPGGGGGGGGGGGGGGGGVSSEKS
GFRVPSATCQPFTPRTGSPSSSASACSPGGMLSSA
GGAPEGKDDKKDTDVGGGGKGTGGASAEGGPTGLA
HGRISCGGGINVDVNQHPDGGPGGKALGSDCGGSS
GSSSGSGPSAPTSSSVLGSGLVAPVSPYKPGQTVF
PLPPAGMTYPGSLAGAYAGYPPQFLPHGVALDPTK
PGSLVGAQLAAAAAGSLGCSKPAGSSPLAGASPPS
VMTASLCRDPYCLSYHCASHLAGAAAASASCAHDP
AAAAAALKSGYPLVYPTHPLHGVHSSLTAAAAAGA
TPPSLAGHPLYPYGFMLPNDPLPHICNWVSANGPC
DKRFATSEELLSHLRTHTAFPGTDKLLSGYPSSSS
LASAAAAAMACHMHIPTSGAPGSPGTLALRSPHHA
LGLSSRYHPYSKSPLPTPGAPVPVPAATGPYYSPY
ALYGQRLTTASALGYQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -