Antibody data

Product number
HPA026442
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026442, RRID:AB_10601237
Product name
Anti-PKDCC
Provider product page
Atlas Antibodies - HPA026442
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLA
EAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGW
SQVVPDPNKTT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.