HPA026427

PKDCC antibody from MilliporeSigma / Merck KGaA
SgK493, Vlk
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026427
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-SGK493 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026427
Antibody type
Polyclonal
Antigen
protein kinase domain containing, cytoplasmic homolog (mouse) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNA
YRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGV
DETLAQLEKVLHLYRSGQ
Storage
-20C