HPA026526

PKDCC antibody from Sigma-Aldrich
SgK493, Vlk
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026526
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026526, RRID:AB_10602416
Product name
Anti-SGK493 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026526
Antibody type
Polyclonal
Antigen
protein kinase domain containing, cytoplasmic homolog (mouse) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFR
ICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDG
ELKVTDLD
Storage
-20C
Provider Type Product Number
- No reagents -