HPA018191

SESN2 antibody from Sigma-Aldrich
DKFZp761M0212, HI95, SES2, SEST2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018191
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018191, RRID:AB_1856750
Product name
Anti-SESN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018191
Antibody type
Polyclonal
Antigen
Sestrin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSS
PPSRDPLNNSGGFESARDVEALMERMQQLQESLLR
DEGTSQEEMESRFELEKSESLLVTPSADILEPSPH
PDMLCFVEDPTFGY
Storage
-20C
Provider Type Product Number
- No reagents -