HPA020098

SLC46A2 antibody from Atlas Antibodies
Ly110, TSCOT

Antibody data

Product number
HPA020098
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020098, RRID:AB_2670363
Product name
Anti-SLC46A2
Provider product page
Atlas Antibodies - HPA020098
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLD
QQYAVGHPPSPGKAKPH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.