HPA015269

TES antibody from Sigma-Aldrich
DKFZP586B2022, TESS-2, TESTIN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015269
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015269, RRID:AB_1857899
Product name
Anti-TES antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015269
Antibody type
Polyclonal
Antigen
Testin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEAL
GVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAM
EDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGY
DKLWHPACFVCSTCHELLVD
Storage
-20C
Provider Type Product Number
- No reagents -