HPA015269

TES antibody from Atlas Antibodies
DKFZP586B2022, TESS-2, TESTIN

Antibody data

Product number
HPA015269
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015269, RRID:AB_1857899
Product name
Anti-TES
Provider product page
Atlas Antibodies - HPA015269
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEAL
GVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAM
EDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGY
DKLWHPACFVCSTCHELLVD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.