Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027436-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00027436-M01, RRID:AB_437001
- Product name
- EML4 monoclonal antibody (M01), clone 3C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant EML4.
- Antigen sequence
MCYTPCKKYTDMNRQFLEKKEHFFKYLGNTALSDQ
QGVYLRTSVTFGVAMYNEIYNHDTLRW- Isotype
- IgG
- Antibody clone number
- 3C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression analysis of EML4 in normal lung tissue and non-small cell lung cancer (NSCLC) in the absence and presence of chemotherapeutics.
Radtke J, Rezaie SG, Kugler Ch, Zabel P, Schultz H, Vollmer E, Goldmann T, Lang DS
Romanian journal of morphology and embryology = Revue roumaine de morphologie et embryologie 2010;51(4):647-53
Romanian journal of morphology and embryology = Revue roumaine de morphologie et embryologie 2010;51(4):647-53
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to EML4 on formalin-fixed paraffin-embedded human prostate cancer. [antibody concentration 10 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol