ABIN501601

KCNMA1 antibody from antibodies-online
KCa1.1, mSLO1, SLO

Antibody data

Product number
ABIN501601
Provider
antibodies-online
Product name
anti-Potassium Large Conductance Calcium-Activated Channel, Subfamily M, alpha Member 1 (KCNMA1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN501601
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the middle region of human KCNMA1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVK
RAFFY CKACHDDITD
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -