Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501601 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Potassium Large Conductance Calcium-Activated Channel, Subfamily M, alpha Member 1 (KCNMA1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the middle region of human KCNMA1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVK
RAFFY CKACHDDITD- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Silencing of hSlo potassium channels in human osteosarcoma cells promotes tumorigenesis.
Cambien B, Rezzonico R, Vitale S, Rouzaire-Dubois B, Dubois JM, Barthel R, Karimdjee BS, Mograbi B, Schmid-Alliana A, Schmid-Antomarchi H
International journal of cancer. Journal international du cancer 2008 Jul 15;123(2):365-71
International journal of cancer. Journal international du cancer 2008 Jul 15;123(2):365-71
No comments: Submit comment
No validations: Submit validation data