Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028543 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028543, RRID:AB_10599302
- Product name
- Anti-OTUD3
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQN
LEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGR
VLKQCGP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Discovery of an OTUD3 inhibitor for the treatment of non-small cell lung cancer
Deubiquitylase OTUD3 prevents Parkinson’s disease through stabilizing iron regulatory protein 2
The deubiquitinase OTUD3 stabilizes ACTN4 to drive growth and metastasis of hepatocellular carcinoma
The deubiquitylase OTUD3 stabilizes GRP78 and promotes lung tumorigenesis
Deubiquitylase OTUD3 regulates PTEN stability and suppresses tumorigenesis
Zhang Y, Du T, Liu N, Wang J, Zhang L, Cui C, Li C, Zhang X, Wu B, Zhang J, Jiang W, Zhang Y, Zhang Y, Li H, Li P
Cell Death & Disease 2023;14(6)
Cell Death & Disease 2023;14(6)
Deubiquitylase OTUD3 prevents Parkinson’s disease through stabilizing iron regulatory protein 2
Jia F, Li H, Jiao Q, Li C, Fu L, Cui C, Jiang H, Zhang L
Cell Death & Disease 2022;13(4)
Cell Death & Disease 2022;13(4)
The deubiquitinase OTUD3 stabilizes ACTN4 to drive growth and metastasis of hepatocellular carcinoma
Xie P, Chen Y, Zhang H, Zhou G, Chao Q, Wang J, Liu Y, Fang J, Xie J, Zhen J, Wang Z, Hao L, Huang D
Aging 2021;13(15):19317-19338
Aging 2021;13(15):19317-19338
The deubiquitylase OTUD3 stabilizes GRP78 and promotes lung tumorigenesis
Du T, Li H, Fan Y, Yuan L, Guo X, Zhu Q, Yao Y, Li X, Liu C, Yu X, Liu Z, Cui C, Han C, Zhang L
Nature Communications 2019;10(1)
Nature Communications 2019;10(1)
Deubiquitylase OTUD3 regulates PTEN stability and suppresses tumorigenesis
Yuan L, Lv Y, Li H, Gao H, Song S, Zhang Y, Xing G, Kong X, Wang L, Li Y, Zhou T, Gao D, Xiao Z, Yin Y, Wei W, He F, Zhang L
Nature Cell Biology 2015;17(9):1169-1181
Nature Cell Biology 2015;17(9):1169-1181
No comments: Submit comment
No validations: Submit validation data