Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028544 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028544, RRID:AB_10602277
- Product name
- Anti-OTUD3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ARNHQLNVVIHQLNAPLWQIRGTEKSSVRELHIAY
RYGEHYDSVRRINDNSEAPAHLQTDFQMLHQDESN
KR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Deubiquitylase OTUD3 Mediates Endoplasmic Reticulum Stress through Regulating Fortilin Stability to Restrain Dopaminergic Neurons Apoptosis
Nicotine-mediated OTUD3 downregulation inhibits VEGF-C mRNA decay to promote lymphatic metastasis of human esophageal cancer
Tumor suppressor OTUD3 induces growth inhibition and apoptosis by directly deubiquitinating and stabilizing p53 in invasive breast carcinoma cells
Chen L, Huan X, Jia F, Zhang Z, Bi M, Fu L, Du X, Chen X, Yan C, Jiao Q, Jiang H
Antioxidants 2023;12(4):809
Antioxidants 2023;12(4):809
Nicotine-mediated OTUD3 downregulation inhibits VEGF-C mRNA decay to promote lymphatic metastasis of human esophageal cancer
Wang M, Li Y, Xiao Y, Yang M, Chen J, Jian Y, Chen X, Shi D, Chen X, Ouyang Y, Kong L, Huang X, Bai J, Lin C, Song L
Nature Communications 2021;12(1)
Nature Communications 2021;12(1)
Tumor suppressor OTUD3 induces growth inhibition and apoptosis by directly deubiquitinating and stabilizing p53 in invasive breast carcinoma cells
Pu Q, Lv Y, Dong K, Geng W, Gao H
BMC Cancer 2020;20(1)
BMC Cancer 2020;20(1)
No comments: Submit comment
No validations: Submit validation data