HPA016493

BPGM antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016493
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016493, RRID:AB_1845414
Product name
Anti-BPGM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016493
Antibody type
Polyclonal
Antigen
Bisphosphoglycerate mutase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLD
QLPRSESLKDVLERLLPYWNERIAPEVLRGKTILI
SAHGNSSRALLKHLEGISDEDIINITLPTGVPILL
ELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVK
QA
Storage
-20C
Provider Type Product Number
- No reagents -