HPA028735

BPGM antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028735
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028735, RRID:AB_10600791
Product name
Anti-BPGM antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028735
Antibody type
Polyclonal
Antigen
2,3-bisphosphoglycerate mutase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKA
LNFEFDLVFTSVLNRSIHTAWLILEELGQEWVPVE
SSWRLNERHYGALIGLNREQMALNHGEEQV
Storage
-20C
Provider Type Product Number
- No reagents -