Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00170850-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00170850-A01, RRID:AB_627423
- Product name
- KCNG3 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant KCNG3.
- Antigen sequence
SRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRE
RNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCEL
SFYNEMIYWGLEGAHLEYCCQRRLDDRMS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references De novo expression of Kv6.3 contributes to changes in vascular smooth muscle cell excitability in a hypertensive mice strain.
Moreno-Domínguez A, Cidad P, Miguel-Velado E, López-López JR, Pérez-García MT
The Journal of physiology 2009 Feb 1;587(3):625-40
The Journal of physiology 2009 Feb 1;587(3):625-40
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- KCNG3 polyclonal antibody (A01). Western Blot analysis of KCNG3 expression in human ovarian cancer.