Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001917-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001917-A01, RRID:AB_489646
- Product name
- EEF1A2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant EEF1A2.
- Antigen sequence
HTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGD
AAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTV
AVGVIKNVEKKSGGAGKVTKSAQKAQKAG- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Degradation of newly synthesized polypeptides by ribosome-associated RACK1/c-Jun N-terminal kinase/eukaryotic elongation factor 1A2 complex.
Dissecting the expression of EEF1A1/2 genes in human prostate cancer cells: the potential of EEF1A2 as a hallmark for prostate transformation and progression.
Gandin V, Gutierrez GJ, Brill LM, Varsano T, Feng Y, Aza-Blanc P, Au Q, McLaughlan S, Ferreira TA, Alain T, Sonenberg N, Topisirovic I, Ronai ZA
Molecular and cellular biology 2013 Jul;33(13):2510-26
Molecular and cellular biology 2013 Jul;33(13):2510-26
Dissecting the expression of EEF1A1/2 genes in human prostate cancer cells: the potential of EEF1A2 as a hallmark for prostate transformation and progression.
Scaggiante B, Dapas B, Bonin S, Grassi M, Zennaro C, Farra R, Cristiano L, Siracusano S, Zanconati F, Giansante C, Grassi G
British journal of cancer 2012 Jan 3;106(1):166-73
British journal of cancer 2012 Jan 3;106(1):166-73
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in human thyroid(diffuse hyperplasia).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in PC-12.