H00001917-A01

antibody from Abnova Corporation

Targeting: EEF1A2 EEF1AL, HS1, STN, STNL

Western blot (Supportive data in Antibodypedia)

Antibody Data

Product number

H00001917-A01

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#H00001917-A01, RRID:AB_489646

Product name

EEF1A2 polyclonal antibody (A01)

Antibody type

Polyclonal

Description

Mouse polyclonal antibody raised against a partial recombinant EEF1A2.

Antigen sequence

HTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGD
AAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTV
AVGVIKNVEKKSGGAGKVTKSAQKAQKAG


Storage

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

Submitted references

Degradation of newly synthesized polypeptides by ribosome-associated RACK1/c-Jun N-terminal kinase/eukaryotic elongation factor 1A2 complex.

Gandin V, Gutierrez GJ, Brill LM, Varsano T, Feng Y, Aza-Blanc P, Au Q, McLaughlan S, Ferreira TA, Alain T, Sonenberg N, Topisirovic I, Ronai ZA
Molecular and cellular biology 2013 Jul;33(13):2510-26

---

Dissecting the expression of EEF1A1/2 genes in human prostate cancer cells: the potential of EEF1A2 as a hallmark for prostate transformation and progression.

Scaggiante B, Dapas B, Bonin S, Grassi M, Zennaro C, Farra R, Cristiano L, Siracusano S, Zanconati F, Giansante C, Grassi G
British journal of cancer 2012 Jan 3;106(1):166-73

Western blot

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in human thyroid(diffuse hyperplasia).

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in PC-12.