Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005753-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005753-M01, RRID:AB_1112072
- Product name
- PTK6 monoclonal antibody (M01), clone 2F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PTK6.
- Antigen sequence
YLSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGIL
LHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLE
CPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTS
YENPT- Isotype
- IgG
- Antibody clone number
- 2F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Olive phenolics as c-Met inhibitors: (-)-Oleocanthal attenuates cell proliferation, invasiveness, and tumor growth in breast cancer models.
Akl MR, Ayoub NM, Mohyeldin MM, Busnena BA, Foudah AI, Liu YY, Sayed KA
PloS one 2014;9(5):e97622
PloS one 2014;9(5):e97622
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to PTK6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol