HPA014059

SEC62 antibody from Sigma-Aldrich
Dtrp1, HTP1, TLOC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014059
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014059, RRID:AB_1858029
Product name
Anti-SEC62 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014059
Antibody type
Polyclonal
Antigen
Translocation protein SEC62 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKA
DLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVG
PGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGN
DFEMITKEELEQQTDGDCEEDEEEENDGETPKSS
Storage
-20C
Provider Type Product Number
- No reagents -