Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014059 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA014059, RRID:AB_1858029
- Product name
- Anti-SEC62
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKA
DLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVG
PGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGN
DFEMITKEELEQQTDGDCEEDEEEENDGETPKSS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mammalian SRP receptor switches the Sec61 translocase from Sec62 to SRP-dependent translocation.
Systematic interrogation of 3q26 identifies TLOC1 and SKIL as cancer drivers.
Jadhav B, McKenna M, Johnson N, High S, Sinning I, Pool MR
Nature communications 2015 Dec 4;6:10133
Nature communications 2015 Dec 4;6:10133
Systematic interrogation of 3q26 identifies TLOC1 and SKIL as cancer drivers.
Hagerstrand D, Tong A, Schumacher SE, Ilic N, Shen RR, Cheung HW, Vazquez F, Shrestha Y, Kim SY, Giacomelli AO, Rosenbluh J, Schinzel AC, Spardy NA, Barbie DA, Mermel CH, Weir BA, Garraway LA, Tamayo P, Mesirov JP, Beroukhim R, Hahn WC
Cancer discovery 2013 Sep;3(9):1044-57
Cancer discovery 2013 Sep;3(9):1044-57
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows positivity in endoplasmic reticulum.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
- Sample type
- HUMAN
