HPA028555

UBXN10 antibody from MilliporeSigma / Merck KGaA
FLJ25429, UBXD3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028555
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028555, RRID:AB_10600417
Product name
Anti-UBXN10 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028555
Antibody type
Polyclonal
Antigen
UBX domain protein 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLSSIRALYQDETGTMKTSEEDSRARACAVERKFI
VRTKKQGSSRAGNLEEPSDQEPRLLLAVRSPTGQ
Storage
-20C
Provider Type Product Number
- No reagents -