Antibody data

Product number
H00023498-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023498-M05, RRID:AB_1137244
Product name
HAAO monoclonal antibody (M05), clone 4D1
Provider product page
Abnova Corporation - H00023498-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HAAO.
Antigen sequence
ANTVGLVVERRRLETELDGLRYYVGDTMDVLFEKW
FYCKDLGTQLAPIIQEFFSSEQYRTGKPIPDQLLK
EPPFPLSTRSIMEPMSLDAWLDSHHRELQA
Isotype
IgG
Antibody clone number
4D1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -