H00079025-B01

FNDC11 antibody from Abnova Corporation
C20orf195, MGC5356

Antibody data

Product number
H00079025-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079025-B01, RRID:AB_1137854
Product name
C20orf195 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00079025-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C20orf195 protein.
Antigen sequence
MSTHVAGLGLDKMKLGNPQSFLDQEEADDQQLLEP
EAWKTYTERRNALREFLTSDLSPHLLKRHHARMQL
LRKCSYYIEVLPKHLALGDQNPLVLPSALFQLIDP
WKFQRMKKVGTAQTKIQLLLLGDLLEQLDHGRAEL
DALLRSPDPRPFLADWALVERRLADVSAVMDSFLT
MMVPGRLHVKHRLVSDVSATKIPHIWLMLSTKMPV
VFDRKASAAHQDWARLRWFVTIQPATSEQYELRFR
LLDPRTQQECAQCGVIPVAACTFDVRNLLPNRSYK
FTIKRAETSTLVYEPWRDSLTLHTKPEPLEGPALS
HSV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -