HPA003041

VPREB3 antibody from Sigma-Aldrich
8HS20
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003041
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003041, RRID:AB_1080577
Product name
Anti-VPREB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003041
Antibody type
Polyclonal
Antigen
Pre-B lymphocyte protein 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQ
QRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDE
AHNACVLTISPVQPEDDADYYCSVGYGFSP
Storage
-20C
Provider Type Product Number
- No reagents -