WH0004238M1

MFAP3 antibody from Sigma-Aldrich
ELISA
Recommended by provider

Antibody data

Product number
WH0004238M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0004238M1, RRID:AB_1842438
Product name
Monoclonal Anti-MFAP3 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0004238M1
Antibody type
Monoclonal
Antigen
MFAP3 (NP_005918, a.a. 262-363) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
DDPDDLGERIKERPALNAQGGIYVINPEMGRSNSP
GGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTES
QGSSHFSPPDDIGSAESNCNYKDGAYENCQL* (w
ithout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -