HPA017676

ENTPD2 antibody from MilliporeSigma / Merck KGaA
CD39L1, NTPDase-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017676
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017676, RRID:AB_1848179
Product name
Anti-ENTPD2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017676
Antibody type
Polyclonal
Antigen
Ectonucleoside triphosphate diphosphohydrolase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGIS
SYADNPSGASQSLVGCLEQALQDVPKERHAGTPLY
LGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFD
FRGARILSGQEEGVFGWVTANYLLENFIKYGW
Storage
-20C
Provider Type Product Number
- No reagents -