HPA015884

FAR2 antibody from MilliporeSigma / Merck KGaA
FLJ10462, MLSTD1, SDR10E2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015884
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA015884, RRID:AB_1853998
Product name
Anti-FAR2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015884
Antibody type
Polyclonal
Antigen
Fatty acyl-CoA reductase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FLGKVLMEKLFRTSPDLKVIYILVRPKAGQTLQQR
VFQILDSKLFEKVKEVCPNVHEKIRAIYADLNQND
FAISKEDMQELLSCTNIIFHCAATVRFDD
Storage
-20C
Provider Type Product Number
- No reagents -