Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20694 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20694, RRID:AB_10961795
- Product name
- TMED2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant TMED2.
- Antigen sequence
DAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVE
ITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFS
NRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKL
EEMINELAVAMTAVKHEQEY- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with TMED2 polyclonal antibody (Cat # PAB20694) at 1:250-1:500 dilution.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of cell lysates with TMED2 polyclonal antibody (Cat # PAB20694) at 1:250-1:500 dilution.Lane 1 : NIH/3T3Lane 2 : NBT-II
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS with TMED2 polyclonal antibody (Cat # PAB20694) at 1-4 ug/mL dilution shows positivity in plasma membrane, cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex with TMED2 polyclonal antibody (Cat # PAB20694) shows strong cytoplasmic positivity in neuronal cells at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)