HPA014060

TMED2 antibody from Sigma-Aldrich
P24A, p24b1, p24beta1, RNP24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014060
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014060, RRID:AB_1856389
Product name
Anti-TMED2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014060
Antibody type
Polyclonal
Antigen
Transmembrane emp24 domain-containing protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVE
ITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFS
NRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKL
EEMINELAVAMTAVKHEQEY
Storage
-20C
Provider Type Product Number
- No reagents -