HPA014060

TMED2 antibody from Atlas Antibodies
P24A, p24b1, p24beta1, RNP24
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014060
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014060, RRID:AB_1235438
Product name
Anti-TMED2
Provider product page
Atlas Antibodies - HPA014060
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVE
ITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFS
NRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKL
EEMINELAVAMTAVKHEQEY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -