HPA026955

TMTC2 antibody from Sigma-Aldrich
DKFZp762A217
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026955
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026955, RRID:AB_10602282
Product name
Anti-TMTC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026955
Antibody type
Polyclonal
Antigen
transmembrane and tetratricopeptide repeat containing 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSPSVDRECNGKTVTNGKQNANGHSCLSDVEYQNS
ETKSSFASKVENGIKNDVSQRTQLPSTEN
Storage
-20C
Provider Type Product Number
- No reagents -