HPA018149

PIGS antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018149
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018149, RRID:AB_1855373
Product name
Anti-PIGS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018149
Antibody type
Polyclonal
Antigen
GPI transamidase component PIG-S recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVLPVRVEVDMVRVMEVFLAQLRLLFGIAQPQLPP
KCLLSGPTSEGLMTWELDRLLWARSVENLATATTT
LTSLAQLLGKISNIVIKDDVASEVYKAVAAVQKSA
EELASGHLASAFVASQEAVTSSELAFFDPSLLHLL
YFPDDQ
Storage
-20C
Provider Type Product Number
- No reagents -