HPA025816

ZNF283 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025816
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA025816, RRID:AB_10602354
Product name
Anti-ZNF345 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA025816
Antibody type
Polyclonal
Antigen
zinc finger protein 345 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLTKHSIECSSFRGDWECKNQFERKQGSQEGHFSE
MIFTPEDMPTFSIQHQRIHTDEKLLECKECGKDFS
FVSVLVRHQRIHTGEKPYECKECGK
Storage
-20C
Provider Type Product Number
- No reagents -