Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00114781-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00114781-M02, RRID:AB_1112638
- Product name
- BTBD9 monoclonal antibody (M02), clone 1G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BTBD9.
- Antigen sequence
RESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTD
EKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN- Isotype
- IgG
- Antibody clone number
- 1G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of BTBD9 expression in transfected 293T cell line by BTBD9 monoclonal antibody (M02), clone 1G3.Lane 1: BTBD9 transfected lysate(65.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to BTBD9 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol