HPA026827
antibody from Atlas Antibodies
Targeting: MUL1
C1orf166, FLJ12875, GIDE, MAPL, MULAN, RNF218
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026827 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-MUL1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EFQEHEAQLLSRAKPEDRESLKSACVVCLSSFKSC
VFLECGHVCSCTECYRALPEPKKCPI- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references SAMM50 acts with p62 in piecemeal basal- and OXPHOS-induced mitophagy of SAM and MICOS components
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Abudu Y, Shrestha B, Zhang W, Palara A, Brenne H, Larsen K, Wolfson D, Dumitriu G, Øie C, Ahluwalia B, Levy G, Behrends C, Tooze S, Mouilleron S, Lamark T, Johansen T
Journal of Cell Biology 2021;220(8)
Journal of Cell Biology 2021;220(8)
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013;10(4):315-323
Nature Methods 2013;10(4):315-323
No comments: Submit comment
No validations: Submit validation data