Explore
Validate
LearnABIN634571
antibody from antibodies-online
Targeting: MUL1
C1orf166, FLJ12875, GIDE, MAPL, MULAN, RNF218
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN634571 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- C1 ORF166 antibody was raised using the middle region of C1 rf166 corresponding to a region with amino acids GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ
- Description
- Affinity purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
No comments: Submit comment
No validations: Submit validation data