HPA017681

MUL1 antibody from Sigma-Aldrich
C1orf166, FLJ12875, GIDE, MAPL, MULAN, RNF218
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017681
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017681, RRID:AB_1848699
Product name
Anti-MUL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017681
Antibody type
Polyclonal
Antigen
Mitochondrial ubiquitin ligase activator of NFKB 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSQELKGAKKVHLGEDLKSILSEAPGKCVPYAVIE
GAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWN
RTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAV
RVLKPLDSVDLGLETVYEKFHPSIQ
Storage
-20C
Provider Type Product Number
- No reagents -